DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG11836

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:247 Identity:75/247 - (30%)
Similarity:118/247 - (47%) Gaps:28/247 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQ-----VLG---STL 89
            |.|:|||.|..||..|:...:.|.|..:|..|:|..:::::||||:....:     :.|   ..:
  Fly    94 EIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEI 158

  Fly    90 VAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTLPSSGVVPT 154
            .:.|.|:.        |::|..:.:..:...|...||.::.......:|..:.|:.||.....|.
  Fly   159 TSESQAIQ--------RAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPA 215

  Fly   155 G-TANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPLTGGVSI 218
            | ...:.|||.||  .....||.:. ...|||:|::.|.:. ..|.:.:.|:.||.|  ...:..
  Fly   216 GRIGTVVGWGRTS--EGGELPSIVN-QVKVPIMSITECRNQ-RYKSTRITSSMLCAG--RPSMDS 274

  Fly   219 CTSDSGGPLVQGN----VLIGIVSWGKLPCGQANSPSVYVQVSSFISWISAN 266
            |..||||||:..|    .::|||||| :.||:...|.||.:||.||.||.:|
  Fly   275 CQGDSGGPLLLSNGVKYFIVGIVSWG-VGCGREGYPGVYSRVSKFIPWIKSN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 71/240 (30%)
Tryp_SPc 36..266 CDD:238113 72/242 (30%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 72/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.