DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG12951

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:296 Identity:92/296 - (31%)
Similarity:132/296 - (44%) Gaps:58/296 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLANGQQTKSLASGLLLLLGICRISGVAIGAPE-GRVVGGSPAAVNSAPYAVSMQ-YGGTHYCAA 63
            ||:|    :.|:..|:::|.   ::.|...||. .|||.|:.::|...|:.||:: |.|:|.|..
  Fly     1 MLSN----QDLSLSLIVILA---VTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGG 58

  Fly    64 SILNANWLVTAAHCLTNSNQVLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTV------ 122
            ||::.::::||||| ||..                   ...|.||.:.|.|....|..|      
  Fly    59 SIISKHFVMTAAHC-TNGR-------------------PADTLSIQFGVTNISAMGPNVVGIKKI 103

  Fly   123 ------------PYDIGMIYTPTAFVW-SAAVAPVTLPS-SGVVPTGTAN----LYGWGSTSTTN 169
                        ..||.::.....|.: ..:||||.||: :..||...|.    |.|||...|  
  Fly   104 IQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDT-- 166

  Fly   170 TASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLI 234
            ..|...||| ..::.|.|...|.|.  ..|......::|.|...||...|:.||||||:.....:
  Fly   167 YGSVQDTLQ-EVSLKIYSDEECTSR--HNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQV 228

  Fly   235 GIVSWGKLPCGQANSPSVYVQVSSFISWISANQQVS 270
            |||||...||..|..|.||.:||.::.||.:||.:|
  Fly   229 GIVSWSIKPCTVAPYPGVYCKVSQYVDWIKSNQIIS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 78/252 (31%)
Tryp_SPc 36..266 CDD:238113 79/254 (31%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 78/252 (31%)
Tryp_SPc 30..260 CDD:238113 79/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.