DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG10587

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:248 Identity:71/248 - (28%)
Similarity:100/248 - (40%) Gaps:47/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RVVGGSPAAVNS--APYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQVLGSTLVAGSIAVD 97
            |||||. ...|:  ..|.::::|.....|..::|:...::|||||.      ||...::..:||.
  Fly    45 RVVGGD-VTTNAQLGGYLIALRYEMNFVCGGTLLHDLIVLTAAHCF------LGRVKISDWLAVG 102

  Fly    98 GTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTLPSSG------------ 150
            | ||....|.|...|...:.:......|:.|         ..|:..:..|..|            
  Fly   103 G-ASKLNDRGIQRQVKEVIKSAEFREDDMNM---------DVAILRLKKPMKGKSLGQLILCKKQ 157

  Fly   151 VVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCE-SALGT-----KGSD----VHST 205
            ::|.....:.|||.|.  |:...|..|.....||::....|. |.|.|     |..|    ||.|
  Fly   158 LMPGTELRVSGWGLTE--NSEFGPQKLLRTVTVPVVDKKKCRASYLPTDWESHKHFDLFLKVHLT 220

  Fly   206 N--LCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQV 256
            :  .|.|.| |....||.|||||||..|.:.||||:| :.|.......||..:
  Fly   221 DSMFCAGVL-GKKDACTFDSGGPLVYKNQVCGIVSFG-IGCASKRYYGVYTDI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 71/248 (29%)
Tryp_SPc 36..266 CDD:238113 70/247 (28%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 71/248 (29%)
Tryp_SPc 46..280 CDD:238113 70/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.