DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG32374

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:251 Identity:75/251 - (29%)
Similarity:101/251 - (40%) Gaps:33/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AIGAPEG------RVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHC-LTNSNQVL 85
            ||.|.|.      |:|.|.....:.|||..::.|.....|...|||..|::||.|| :.|..:. 
  Fly    60 AINALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPGRY- 123

  Fly    86 GSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTLPSSG 150
              |:.|||..   .....|.|.:...|.:..|:..|:..|:.|:...|.......|..|.|||  
  Fly   124 --TVRAGSTQ---QRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPS-- 181

  Fly   151 VVPTGTANL------YGWGSTSTT--NTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNL 207
               |.|...      .|||.||..  |...|...:.|..    :|.:.|:......|..::...:
  Fly   182 ---TRTKRFPKCYLASGWGLTSANAQNVQRYLRGVIVCK----VSRAKCQQDYRGTGIKIYKQMI 239

  Fly   208 CTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISWI 263
            |.  .......|:.|||||||...||.||.|:| :.|..|..|.|||.|..:..||
  Fly   240 CA--KRKNRDTCSGDSGGPLVHNGVLYGITSFG-IGCASAKYPGVYVNVLQYTRWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 69/236 (29%)
Tryp_SPc 36..266 CDD:238113 70/237 (30%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 69/236 (29%)
Tryp_SPc 74..295 CDD:238113 70/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.