DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG16998

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:250 Identity:68/250 - (27%)
Similarity:120/250 - (48%) Gaps:15/250 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLLLGICRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTN 80
            |:||.||.....|: :|:.|:|||....::..|:..|:...|.:.|:::::.:.|||||.||:..
  Fly     6 LILLLICGHKTSAL-SPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQY 69

  Fly    81 SNQVLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFV--WSAAVAP 143
            .:..   ::.|||...||..   |.|::...:::..:...|:..||.::....:|.  .:..|..
  Fly    70 PDSY---SVRAGSTFTDGGG---QRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVK 128

  Fly   144 VTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLC 208
            :.|||..::|. |..:.|||:...|::.|.|...  .|.|.:|:...|:.........:....:|
  Fly   129 LPLPSLNILPR-TLLVAGWGNPDATDSESEPRLR--GTVVKVINQRLCQRLYSHLHRPITDDMVC 190

  Fly   209 TGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISWI 263
            ..  ..|...|..|||.|||......||||:.. .|...:.|.||.:::::::||
  Fly   191 AA--GAGRDHCYGDSGAPLVHRGSSYGIVSFAH-GCADPHFPGVYTRLANYVTWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 59/229 (26%)
Tryp_SPc 36..266 CDD:238113 59/229 (26%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 59/229 (26%)
Tryp_SPc 25..242 CDD:238113 58/228 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455704
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.