DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG32271

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:267 Identity:77/267 - (28%)
Similarity:117/267 - (43%) Gaps:46/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLLLLGICRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLT 79
            |.|:|.:..:...|......|:|||.|..:.|.||.|:::.||...|..|::....:||||||:.
  Fly     4 LWLVLHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVK 68

  Fly    80 NSNQVLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAF-----VWSA 139
            .    :|::.:   :.|.|....|:|               .|...:..:|||.|:     ....
  Fly    69 G----IGASRI---LVVAGVTRLTET---------------GVRSGVDKVYTPKAYNTRTLTSDV 111

  Fly   140 AVAPVTLPSSG-VVPT-----------GTANLYGWGSTSTTNTASYPSTLQV-ATNVPIISLSSC 191
            ||..:..|.|| .|.|           ....:.|||..:..|.|   .::|| :.:|.:|...:|
  Fly   112 AVLKLKAPISGPKVSTIELCNTSFKAGDLIKVSGWGQITERNKA---VSMQVRSVDVALIPRKAC 173

  Fly   192 ESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQV 256
            .|....:|: :.:|..|.. :.|....|..|||||.|....|.|||||| :.|.:.:||.||..|
  Fly   174 MSQYKLRGT-ITNTMFCAS-VPGVKDACEGDSGGPAVYQGQLCGIVSWG-VGCARKSSPGVYTNV 235

  Fly   257 SSFISWI 263
            .:..|:|
  Fly   236 KTVRSFI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 72/245 (29%)
Tryp_SPc 36..266 CDD:238113 72/246 (29%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 72/245 (29%)
Tryp_SPc 25..244 CDD:238113 72/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455683
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.