DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and KLK1

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_002248.1 Gene:KLK1 / 3816 HGNCID:6357 Length:262 Species:Homo sapiens


Alignment Length:266 Identity:82/266 - (30%)
Similarity:120/266 - (45%) Gaps:32/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLLLLGICRISGVAIGAP-EGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCL 78
            |:|.|.: .:.|.....| :.|:|||.....:|.|:..::.:..|..|...:::..|::|||||:
Human     4 LVLCLAL-SLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCI 67

  Fly    79 TNSNQV-LGS------------TLVAGSIAVDG---TASTTQTRSITYFVINDLYTGGTVPYDIG 127
            :::.|: ||.            ..|:.|....|   :.....||.......:||..         
Human    68 SDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLML--------- 123

  Fly   128 MIYTPTAFVWSAAVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCE 192
            :..|..|...:.||..|.||:.......|....||||....| .|:|..|| ..::.|:....|:
Human   124 LRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPEN-FSFPDDLQ-CVDLKILPNDECK 186

  Fly   193 SALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVS 257
            .|...|.:|.   .||.|.|.||...|..||||||:...||.|:.|||.:|||..|.|||.|:|.
Human   187 KAHVQKVTDF---MLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVL 248

  Fly   258 SFISWI 263
            |::.||
Human   249 SYVKWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 75/243 (31%)
Tryp_SPc 36..266 CDD:238113 76/244 (31%)
KLK1NP_002248.1 Tryp_SPc 25..257 CDD:238113 76/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.