DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG3650

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:258 Identity:81/258 - (31%)
Similarity:124/258 - (48%) Gaps:32/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLLLGICR-ISGVAIGAPEGRVVGGSPAAVNS-APYAVSMQYGGTHYCAASILNANWLVTAAHCL 78
            |.||.:.: :.|:|.|..:.|:|||:...::: ..:.|:::|.||.||..|::.::.:|||||||
  Fly     5 LFLLQLTQLLLGLASGQIQPRIVGGTTTTLSAVGGFVVNLRYDGTFYCGGSLVTSSHVVTAAHCL 69

  Fly    79 TNSNQVLGSTLVAGSIAVDGTASTTQTRSIT-----YFVINDLYTGGTVPYDIGMIYTPTAFVWS 138
            ....        |..|.|.|..|......:.     ||:.|. ::..::.:|:|:|...:|...|
  Fly    70 KGYQ--------ASRITVQGGVSKLSQSGVVRRVARYFIPNG-FSSSSLNWDVGVIRLQSALTGS 125

  Fly   139 AAVAPVTLPSSGVV--PTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSD 201
            ..   .|:|...|.  |.....:.|||:|...|  |.||.......:.:|....|:.|.  :|.|
  Fly   126 GI---TTIPLCQVQWNPGNYMRVSGWGTTRYGN--SSPSNQLRTVRIQLIRKKVCQRAY--QGRD 183

  Fly   202 -VHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYV---QVSSFI 260
             :.::..|.  .|||...|:.||||.::..|.|.|||||| |.|..|..|.||.   :|.|||
  Fly   184 TLTASTFCA--RTGGKDSCSGDSGGGVIFKNQLCGIVSWG-LGCANAQYPGVYTSVHRVRSFI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 75/238 (32%)
Tryp_SPc 36..266 CDD:238113 74/237 (31%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 73/236 (31%)
Tryp_SPc 26..243 CDD:238113 72/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455691
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.