DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG13430

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:249 Identity:75/249 - (30%)
Similarity:117/249 - (46%) Gaps:34/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQVLGSTLVAGSIAVD 97
            :||:|||....:...|:.||:|.|..|.|..:|::.|.::|||||:...::.....:.||     
  Fly    29 DGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAG----- 88

  Fly    98 GTASTTQTRSITYFVINDLYTGGTVPY-----------DIGMIYTPTAFVWSAAVAPVTLPSSG- 150
               |:..|:..:|..:..:     :|:           ||.::......|:|..:.|::|.:|. 
  Fly    89 ---SSDWTKGGSYIRVKKI-----IPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKD 145

  Fly   151 -VVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPLTG 214
             ::||....:.||||||.:.  ..|......|.|.:...:.|.......|: |.:|..|.|...|
  Fly   146 IIMPTAQLFVSGWGSTSISQ--MQPEKRLRYTVVHLRDQNQCARNYFGAGT-VTNTMFCAGTQAG 207

  Fly   215 GVSICTSDSGGPLV---QGNV-LIGIVSWGKLPCGQANSPSVYVQVSSFISWIS 264
            |...|..|||||||   .|.: |.|||||| ..|..|..|.:|.:||::..||:
  Fly   208 GRDSCQGDSGGPLVTSIDGRLKLYGIVSWG-FGCANAMFPGIYTKVSAYDDWIA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 72/244 (30%)
Tryp_SPc 36..266 CDD:238113 73/246 (30%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 72/244 (30%)
Tryp_SPc 32..262 CDD:238113 73/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.