DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG32269

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:241 Identity:64/241 - (26%)
Similarity:112/241 - (46%) Gaps:22/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQVLGSTLVAGSIAVD 97
            :.|:|||:...:::.||.|.:: .|::.|:.|::...|::|||||: ........|:..|:..:|
  Fly   106 QSRIVGGTSTTISTTPYIVQLR-RGSNLCSGSLITEQWVLTAAHCV-KGYSASDFTVRGGTTTLD 168

  Fly    98 GTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTL----PSSGVVPTGTAN 158
            |  |...|||::...:...:|...:..|..::....:.. ...:..:::    |.:|    ....
  Fly   169 G--SDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLT-GTNIGTISMGNYRPKAG----SRVR 226

  Fly   159 LYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDS 223
            :.|||.|...:|.: ..|||.| .:.::....|......:.: :....||.  ...|...|:.||
  Fly   227 IAGWGVTKEGSTTA-SKTLQTA-QIRVVRQQKCRKDYRGQAT-ITKYMLCA--RAAGKDSCSGDS 286

  Fly   224 GGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISW---ISAN 266
            |||:.:.|.|:||||:| ..|.:|..|.||..|.:...|   |.||
  Fly   287 GGPVTRNNTLLGIVSFG-YGCARAGYPGVYTAVVAIRQWATNIMAN 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 61/234 (26%)
Tryp_SPc 36..266 CDD:238113 61/236 (26%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 60/230 (26%)
Tryp_SPc 121..324 CDD:238113 56/217 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.