DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG32270

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:236 Identity:68/236 - (28%)
Similarity:117/236 - (49%) Gaps:15/236 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQVLGSTLVAGSIAVDGT 99
            |:|||.|:.|...|:.|:::..|...|..|::....::||||||.:.|.  ...:|.|.:..  .
  Fly    30 RIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNP--SDFVVRGGVTY--L 90

  Fly   100 ASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVA-PVTLPSSGVVPTGTANLYGWG 163
            :....:|.:...::...|:..|:.:|:.::......  .|::| |::|......|.....:.|||
  Fly    91 SDMRNSRYVRKILMPSAYSRTTLDHDVALLQLKQPL--QASIAKPISLAVRSPRPGSFVRVSGWG 153

  Fly   164 STSTTNTASYPSTLQVATNVPIISLSSCESALGTKG-SDVHSTNLCTGPLTGGVSICTSDSGGPL 227
            .|.:::| |.|:.|| :.:|.::....|....  :| .::.|:..|.. :.|....|..|||||:
  Fly   154 LTDSSST-SLPNQLQ-SVHVQVMPQRECRDLY--RGYRNITSSMFCAS-VPGLKDACAGDSGGPV 213

  Fly   228 VQGN-VLIGIVSWGKL-PCGQANSPSVYVQVSSFISWISAN 266
            |..| :|:|:||||:. .|...:||.||..||....||:.|
  Fly   214 VNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 65/231 (28%)
Tryp_SPc 36..266 CDD:238113 66/233 (28%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 65/231 (28%)
Tryp_SPc 31..254 CDD:238113 66/233 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455651
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.