DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG9897

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:279 Identity:64/279 - (22%)
Similarity:114/279 - (40%) Gaps:49/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLLLGICRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCL-- 78
            |:||.|..:..:|:|  :.|::.|:...:..||:..|:.......|..:|::.|:::|||.|:  
  Fly     5 LILLQIVALPWLALG--DQRIINGNTVNIKDAPWYASIIVNSKLKCGGAIISKNYILTAAKCVDG 67

  Fly    79 --TNSNQV-LGSTL--VAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWS 138
              ..|.|| ||::.  .:||||           .|....::..|:......::.::.|......:
  Fly    68 YSARSIQVRLGTSSCGTSGSIA-----------GICKVKVHSQYSSWRFDNNLALLKTCELLNTT 121

  Fly   139 AAVAPVTLPSSGVVPTGTANLYGWGS--------------TSTTNTASYPSTLQV-ATNVPIISL 188
            ..:.|:............||:.|.|.              :|......:...:|: .|.|.|:|.
  Fly   122 DEIKPIERADKVPDDNSRANVTGCGGRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRILSQ 186

  Fly   189 SSCESALGT------KGSDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQA 247
            ..|.:....      ||  :....:||  .:.|...|::|.|.|||..|.|:||:|    ..|.:
  Fly   187 KQCAADWKVIPFYLLKG--ISDLTICT--KSPGKGACSTDRGSPLVIDNKLVGILS----RAGCS 243

  Fly   248 NSPSVYVQVSSFISWISAN 266
            ..|.||..:....:|:.:|
  Fly   244 IKPDVYANILGHTNWLDSN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 56/255 (22%)
Tryp_SPc 36..266 CDD:238113 56/257 (22%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 56/254 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.