DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG32833

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:292 Identity:66/292 - (22%)
Similarity:112/292 - (38%) Gaps:69/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LASGLLLLLGICRISGVAIGAPEG-----------RVVGGSPAAVNSAPYAVSMQYGGTHYCAAS 64
            |...|.:.|.:..:|....||.|.           ..:||.|..:.:||:..|:.......|..:
  Fly     2 LLRSLPIFLALFVLSKSDTGAGEDSEEDDENDCNRTTLGGHPVNITTAPWIASISIKQKAKCDGA 66

  Fly    65 ILNANWLVTAAHCLTN-SNQVL----GSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPY 124
            |...:.:|||..|:.. .|:|:    |||..:     ||....    ::....:::.:||.||.:
  Fly    67 IYKLSHIVTAGKCVDGFLNKVIRVRVGSTTRS-----DGVIEV----AVCNITVHEKFTGQTVFH 122

  Fly   125 DIGMIYTPTAFVWSAAVAPV----TLPSSGVVPTGTANLYGWGS--------TSTTNTASYPSTL 177
            ::.::........|..:.|:    .|||:|.  ..|||  ||.|        ....:..:|  .|
  Fly   123 NVAILKLCEPLEASKTIQPIQLANQLPSNGA--KVTAN--GWPSFRWWAMYWKKCLDDEAY--KL 181

  Fly   178 QVATNVPIISLSSCESALGTKGSDVHSTN-----------LCTGPLTGGVSICTSDSGGPLVQGN 231
            |.| .|.::..|.|        :|:.:.|           .||...  ....|:...|.|:|...
  Fly   182 QKA-EVKLLGPSQC--------TDLWARNNWSKKNFTDDLFCTEKF--AKEACSLAMGSPVVHNG 235

  Fly   232 VLIGIVSWGKLPCGQANSPSVYVQVSSFISWI 263
            .|:||::.|    |.:..|.||:.:..:..|:
  Fly   236 KLVGIITKG----GCSEYPEVYINLIKYKDWL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 58/255 (23%)
Tryp_SPc 36..266 CDD:238113 59/256 (23%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 59/254 (23%)
Tryp_SPc 40..262 CDD:214473 58/251 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.