DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG8299

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:265 Identity:90/265 - (33%)
Similarity:123/265 - (46%) Gaps:25/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLASGLLLLLGICRISGVAI----GAPEGRVVGGSPAAVNSAPYAVSMQ---YGGTHYCAASILN 67
            ||..||.||..:    ||.|    .:....:|||..|.:...||.||::   |...|.|..||..
  Fly     2 SLRLGLFLLAAL----GVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYA 62

  Fly    68 ANWLVTAAHCLTNSNQVLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTP 132
            ...::|||||: .........:|||..::.....  |...::..:.:..|...|...|||:|.|.
  Fly    63 PRVVITAAHCI-KGRYASYIRIVAGQNSIADLEE--QGVKVSKLIPHAGYNKKTYVNDIGLIITR 124

  Fly   133 TAFVWSAAVAPVTL----PSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCES 193
            ....:||.|.|:.:    |.||    ..|.:.|||..:..:.| .|:.|: |..:.||..|:|.:
  Fly   125 EPLEYSALVQPIAVALEAPPSG----AQAVVSGWGKRAEDDEA-LPAMLR-AVELQIIEKSTCGA 183

  Fly   194 ALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSS 258
            ...||...|....||.|.|.||...|..||||||....||:|:|||| :.||:...|.||..|:|
  Fly   184 QYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWG-VGCGREGFPGVYTSVNS 247

  Fly   259 FISWI 263
            .|.||
  Fly   248 HIDWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 79/234 (34%)
Tryp_SPc 36..266 CDD:238113 81/235 (34%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 79/234 (34%)
Tryp_SPc 28..255 CDD:238113 81/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.