DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Ser8

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:271 Identity:82/271 - (30%)
Similarity:132/271 - (48%) Gaps:29/271 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LASGLLLLLGICRISGVAIG-APE-----GRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNAN 69
            |.:..|.||.:...:.:.|| .|:     ||:|||:.:::...|:.||:|..|:|:|..||::.|
  Fly     4 LIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNN 68

  Fly    70 WLVTAAHCLTNSNQVLGSTLVAGS-------IAVDGTASTTQTRSITYFVINDLYTGGTVPYDIG 127
            .:|||||||.....|....:.|||       :.|:          :.....::.|...:...|||
  Fly    69 IIVTAAHCLDTPTTVSNLRIRAGSNKRTYGGVLVE----------VAAIKAHEAYNSNSKINDIG 123

  Fly   128 MIYTPTAFVWSAAVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCE 192
            ::...|...:.:.:..:|:.|:.......|::.|||.|||...:|  :|| :..:..|:..|.|.
  Fly   124 VVRLKTKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDGPSS--ATL-LFVDTRIVGRSQCG 185

  Fly   193 SALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVS 257
            |:....||.:.:|.:|..  ......|..|||||||.|..|:|:||||: .|..||.|.||..::
  Fly   186 SSTYGYGSFIKATMICAA--ATNKDACQGDSGGPLVSGGQLVGVVSWGR-DCAVANYPGVYANIA 247

  Fly   258 SFISWISANQQ 268
            ....|:...|:
  Fly   248 ELRDWVLQAQK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 72/234 (31%)
Tryp_SPc 36..266 CDD:238113 72/236 (31%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 72/234 (31%)
Tryp_SPc 35..253 CDD:238113 71/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.