DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and iotaTry

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster


Alignment Length:269 Identity:80/269 - (29%)
Similarity:116/269 - (43%) Gaps:47/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLLLLGICRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLT 79
            :|||||  ..|.|   ...||::|||...:.:||:.||:|....|.|...|.:...::||.|||.
  Fly    12 VLLLLG--DASDV---EATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLH 71

  Fly    80 N------------SNQVLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTP 132
            .            .|...|.|||                .:..:.:::.:....:.|||.::...
  Fly    72 ERSVTLMKVRVGAQNHNYGGTLV----------------PVAAYKVHEQFDSRFLHYDIAVLRLS 120

  Fly   133 TAFVWSAAVAPVTLPSSGVVPTG--TANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESAL 195
            |...:..:...:.|.|:.  |:|  |..:.|||.   |:..:...:||.| .:.||....|.|..
  Fly   121 TPLTFGLSTRAINLASTS--PSGGTTVTVTGWGH---TDNGALSDSLQKA-QLQIIDRGECASQK 179

  Fly   196 GTKGSD-VHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSF 259
            ...|:| |....:|..  :.....||.|||||||..:.|:|||||| ..|...|.|.||..|:..
  Fly   180 FGYGADFVGEETICAA--STDADACTGDSGGPLVASSQLVGIVSWG-YRCADDNYPGVYADVAIL 241

  Fly   260 ISWI--SAN 266
            ..||  :||
  Fly   242 RPWIVKAAN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 68/242 (28%)
Tryp_SPc 36..266 CDD:238113 69/246 (28%)
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 68/242 (28%)
Tryp_SPc 28..247 CDD:238113 69/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.