DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and TMPRSS7

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001382436.1 Gene:TMPRSS7 / 344805 HGNCID:30846 Length:843 Species:Homo sapiens


Alignment Length:245 Identity:80/245 - (32%)
Similarity:118/245 - (48%) Gaps:30/245 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQVLGSTLVAGSIA--VD 97
            |::||:.......|:.||:.:.|:.||.||:::..||::||||. :.|::...|.....:.  |.
Human   605 RIIGGTDTLEGGWPWQVSLHFVGSAYCGASVISREWLLSAAHCF-HGNRLSDPTPWTAHLGMYVQ 668

  Fly    98 GTAS-TTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVW----SAAVAPVTLPSSGV-VPTG- 155
            |.|. .:..|.|   |:::.|...|..|||.::....|  |    ...:.|:.:|.:|. |.:| 
Human   669 GNAKFVSPVRRI---VVHEYYNSQTFDYDIALLQLSIA--WPETLKQLIQPICIPPTGQRVRSGE 728

  Fly   156 TANLYGWGST-STTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPLTGGVSIC 219
            ...:.|||.. ...|..|.  .||.| .|.:|..:.|.|..|.    :.|..||.|.::|....|
Human   729 KCWVTGWGRRHEADNKGSL--VLQQA-EVELIDQTLCVSTYGI----ITSRMLCAGIMSGKRDAC 786

  Fly   220 TSDSGGPL-----VQGN-VLIGIVSWGKLPCGQANSPSVYVQVSSFISWI 263
            ..||||||     ..|. :|.||||||. ..|:.|.|.||.:||:|:.||
Human   787 KGDSGGPLSCRRKSDGKWILTGIVSWGH-GSGRPNFPGVYTRVSNFVPWI 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 78/243 (32%)
Tryp_SPc 36..266 CDD:238113 79/244 (32%)
TMPRSS7NP_001382436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..67
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.