DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and PRSS53

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:324 Identity:70/324 - (21%)
Similarity:118/324 - (36%) Gaps:80/324 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LASGLLLLLGI------CRISGVAIGAP-EGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNA 68
            :|...:|:.|:      |...|.....| ||..|.|      ..|:..|::..|.|.|:.|::..
Human    11 IAGATVLMEGLQAAQRACGQRGPGPPKPQEGNTVPG------EWPWQASVRRQGAHICSGSLVAD 69

  Fly    69 NWLVTAAHCLTN--SNQVLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYT 131
            .|::|||||...  :.::...::|.||:..:|.:...:...:....:...|...:...|:.::..
Human    70 TWVLTAAHCFEKAAATELNSWSVVLGSLQREGLSPGAEEVGVAALQLPRAYNHYSQGSDLALLQL 134

  Fly   132 --PTAFVWSAAVAPVTLP--------SSGVVPTG----TANLYGWGSTSTTNTASYPSTLQVATN 182
              ||..      .|:.||        .:....||    |::...|...........||....|.|
Human   135 AHPTTH------TPLCLPQPAHRFPFGASCWATGWDQDTSDGKCWPRLKLGEALCLPSVTVSAPN 193

  Fly   183 VP--------------------------------IISLSSCESALGTKGSDVHSTN------LCT 209
            .|                                :||..:| :.:..:....|.:|      ||.
Human   194 CPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLRLRLISRPTC-NCIYNQLHQRHLSNPARPGMLCG 257

  Fly   210 GPLTGGVSICTSDSGGPLV----QGN-VLIGIVSWGKLPCGQANSPSVYVQVSSFISWISANQQ 268
            ||..|....|..|||||::    .|: |..||:|:.. .|.|.::|.:....::..||:.|..|
Human   258 GPQPGVQGPCQGDSGGPVLCLEPDGHWVQAGIISFAS-SCAQEDAPVLLTNTAAHSSWLQARVQ 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 59/286 (21%)
Tryp_SPc 36..266 CDD:238113 60/288 (21%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 60/287 (21%)
Tryp_SPc 43..314 CDD:214473 58/284 (20%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.