DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG4271

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:284 Identity:64/284 - (22%)
Similarity:99/284 - (34%) Gaps:80/284 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLLGICRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNS 81
            :|:|.|.:. :........:..|..|..:...:..|:...|.|.|..:::::..::|||.|:.|.
  Fly     1 MLIGSCWVL-ILFARSSNGIYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKNK 64

  Fly    82 NQVLGSTLVAGSIAVDGTASTTQTRSITYFV-INDLYTGGTV---------------PYDIGMIY 130
                                  ..:.||..| ..|:|.||.:               ..||.:::
  Fly    65 ----------------------PVKRITVRVGTPDIYRGGRIIRVTALVVHENYKNWDNDIALLW 107

  Fly   131 TPTAFVWSAAVAPVTL----PSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSC 191
            .... |.|..|..:.|    ||....|:..    |||...   ..||..|.::...|        
  Fly   108 LEKP-VLSVRVTKIPLATKEPSENEYPSNA----GWGEKL---LESYVVTRKLQNGV-------- 156

  Fly   192 ESALGTKGSDVHSTNLCTGPLTGGV------------SICTSDSGGPLVQGNVLIGIVSWGKLPC 244
                 ||   :...::|...|...|            .||..|.|||||..|.::||...|. .|
  Fly   157 -----TK---IRPRSMCAEELVEPVGEELLCAFYTENDICPGDYGGPLVLANKVVGIAVQGH-GC 212

  Fly   245 GQANSPSVYVQVSSFISWISANQQ 268
            |.|..||:|..|..::.||..|.:
  Fly   213 GFAVLPSLYTNVFHYLEWIEENAE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 58/259 (22%)
Tryp_SPc 36..266 CDD:238113 60/261 (23%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 60/261 (23%)
Tryp_SPc 19..231 CDD:214473 58/258 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.