DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Send1

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster


Alignment Length:237 Identity:65/237 - (27%)
Similarity:110/237 - (46%) Gaps:28/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQVL--GSTL-VAGS 93
            |..|::|||...:...|:.||:||.|.|:|..||.:...::|||||:....:.:  ||:| .:|.
  Fly    26 PSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCIKEGERSIRAGSSLHDSGG 90

  Fly    94 IAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTLPSSGVVPTGTAN 158
            :.|          .:..::|:..:....:..|:.::...:...:|.::..:.|..:....:.:|.
  Fly    91 VVV----------GVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSAL 145

  Fly   159 LYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPL-TGGVSICTSD 222
            ..|||   ..|....|..|| ...:.|..|..|:...   |:.|.:.::|.|.: .||   |..|
  Fly   146 ATGWG---RGNFLIRPRQLQ-GVEILIRPLIVCKLKY---GNGVFNEDICAGRMGKGG---CYGD 200

  Fly   223 SGGPLVQGNVLIGIVS-WGKLPCGQANSPSVYVQVSSFISWI 263
            ||||||....|:||.| .|.:.|   ...|:|..|:.:.:||
  Fly   201 SGGPLVFNGQLVGITSRTGNIVC---LGSSLYASVARYRNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 62/232 (27%)
Tryp_SPc 36..266 CDD:238113 63/233 (27%)
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 62/232 (27%)
Tryp_SPc 30..239 CDD:238113 61/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.