DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG11911

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:243 Identity:90/243 - (37%)
Similarity:136/243 - (55%) Gaps:22/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GRVVGGSPAAVNSAPYAVSMQYG---GTHYCAASILNANWLVTAAHCLTNSNQVLGSTLVAGSIA 95
            |.|:.|:.|..:||||.||:...   .:|.|..:::|.:|:||||||:   ::.:|.:::||...
  Fly    35 GFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCI---SEPVGMSIIAGLHT 96

  Fly    96 VDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTLPSSGVVPTGTANLY 160
            .......||.|.:.:..:::.||||..||||.:::...:|:::..|.|.||||...|..|..:||
  Fly    97 RAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLY 161

  Fly   161 GWGSTSTTNTASY----PSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPLTGGVSICTS 221
            |||...     ||    ..|||..| ..|::...|:..| .:.:.:..:|:|:..|....|.|..
  Fly   162 GWGQPK-----SYIFSGAKTLQTVT-TQILNYEECKEEL-PESAPIAESNICSSSLQQSKSACNG 219

  Fly   222 DSGGPLV-----QGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISWIS 264
            |||||||     ..:.||||||||.:|||.||.||:|.:||::|.||:
  Fly   220 DSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWIT 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 87/239 (36%)
Tryp_SPc 36..266 CDD:238113 89/241 (37%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 89/241 (37%)
Tryp_SPc 37..266 CDD:214473 87/238 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455580
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQSN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D36714at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.