DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG1304

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:276 Identity:81/276 - (29%)
Similarity:119/276 - (43%) Gaps:42/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LASGLLLLLGICRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAA 75
            |....||||.:...|  |.|:..||||||..|..|..|:.||::..|:|.|..|||:.|:::|||
  Fly     9 LLGSFLLLLAVPVHS--APGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAA 71

  Fly    76 HCLTN--SNQVLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPY-------------- 124
            ||:||  ||        ..|:.:.....|.:..|      ||.::||.:..              
  Fly    72 HCVTNQDSN--------GNSVPIAAERFTIRAGS------NDRFSGGVLVQVAEVIVHEEYGNFL 122

  Fly   125 -DIGMIYTPTAFVWSAAVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISL 188
             |:.::...:..:.||::.|:.||::.........:.|||...  :....|..||..| :..|||
  Fly   123 NDVALLRLESPLILSASIQPIDLPTADTPADVDVIISGWGRIK--HQGDLPRYLQYNT-LKSISL 184

  Fly   189 SSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVY 253
            ..|:..:|.   .|.|..........|.  |..|||||.|..|.::|:..:....|| .:.|..|
  Fly   185 ERCDELIGW---GVQSELCLIHEADNGA--CNGDSGGPAVYNNQVVGVAGFVWSACG-TSYPDGY 243

  Fly   254 VQVSSFISWISANQQV 269
            .:|.....||..|..|
  Fly   244 ARVYYHNEWIKNNSDV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 68/244 (28%)
Tryp_SPc 36..266 CDD:238113 69/246 (28%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 68/244 (28%)
Tryp_SPc 32..256 CDD:238113 69/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.