DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Ser6

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:268 Identity:75/268 - (27%)
Similarity:111/268 - (41%) Gaps:58/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNS--NQVLGS--- 87
            |.|...||||||..|..|..|:.||::..|:|.|..|||...:::|||||::|.  |.|:..   
  Fly    24 APGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAA 88

  Fly    88 ---TLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPY---------------DIGMIYTPTA 134
               |:.|||                    ||.::||.:..               |:.::...:.
  Fly    89 ERFTIRAGS--------------------NDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLESP 133

  Fly   135 FVWSAAVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESAL--GT 197
            .:.||::.|:.||:..........:.|||...  :....|..||..| :..|:...||..:  |.
  Fly   134 LILSASIQPIDLPTVDTPADVDVVISGWGRIK--HQGDLPRYLQYNT-LKSITRQQCEELIDFGF 195

  Fly   198 KGSDVHSTNLC-TGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFIS 261
            :|      .|| ...:..|.  |..|||||.|..|.|:|:..:....|| :..|..|.:|..|..
  Fly   196 EG------ELCLLHQVDNGA--CNGDSGGPAVYNNQLVGVAGFVVDGCG-STYPDGYARVFYFKD 251

  Fly   262 WISANQQV 269
            ||..:..|
  Fly   252 WIKKHSDV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 69/253 (27%)
Tryp_SPc 36..266 CDD:238113 70/255 (27%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 69/253 (27%)
Tryp_SPc 32..256 CDD:238113 70/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.