DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Prss53

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:264 Identity:65/264 - (24%)
Similarity:115/264 - (43%) Gaps:28/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ASGLLLLLGICRISG----VAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLV 72
            |:.|:...|:.::|.    ||.|:.  |..|....|::..|:...:::.|...|..::::...::
Mouse   275 AAFLVQAPGVVKMSDENSCVACGSL--RSAGPQAGALSQWPWDARLKHHGKLACGGALVSEVVVL 337

  Fly    73 TAAHCLTNSNQVLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVW 137
            |||||....     .||...|:   |..:..:...:...:::..||.....||:..:........
Mouse   338 TAAHCFIGR-----QTLEEWSV---GLGAGPEEWGLKQLILHGAYTHPEGGYDVAFLLLAQPVTL 394

  Fly   138 SAAVAPVTLP-SSGVVPTGTANLYGW--GSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKG 199
            ...:.|:.|| :...:|.|.   :||  |.|.... .:||.|:.|....| ::.|...:|.|..|
Mouse   395 GPGLRPLCLPYADHHLPDGE---HGWVLGLTQKAG-INYPQTVPVTVLGP-MACSRQHAAPGGTG 454

  Fly   200 SDVHSTNLCTGPLTGGVSICTSDSGGPLV---QGN-VLIGIVSWGKLPCGQANSPSVYVQVSSFI 260
            ..:....:|| .:.|....|...||.|||   :|. .|:|:.|:|. .|..:..|:|:..:|::.
Mouse   455 IPILPGMVCT-TVVGEPPHCEGLSGAPLVHEIRGTWFLVGLHSFGD-TCQSSAKPAVFAALSAYE 517

  Fly   261 SWIS 264
            .|||
Mouse   518 DWIS 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 55/234 (24%)
Tryp_SPc 36..266 CDD:238113 57/236 (24%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46
Tryp_SPc 45..271 CDD:238113
Tryp_SPc 311..522 CDD:238113 55/226 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.