DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG9676

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:254 Identity:70/254 - (27%)
Similarity:119/254 - (46%) Gaps:22/254 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLGICRISGVAI---GAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLT 79
            ||.:| .:||..   ...|.|:|||:.|.....|:.:|::..|:|.|..||::.:::||||||:.
  Fly     8 LLVLC-AAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVK 71

  Fly    80 NSNQVLGST---LVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAV 141
            ..|.|..:.   :.|||:.:..........::|   ::..|...  .:|:.::....:..:::.:
  Fly    72 QGNNVAPANELEIQAGSLLLSSGGVRVPVATVT---VHPNYNSN--GHDVAVLRLRNSLTFNSNI 131

  Fly   142 APVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTN 206
            |.:.|.:.......|.::.|||:.|.....| .|.|.|  .|..:|..||:.   |....:..|.
  Fly   132 AAIKLATEDPPNDATVDISGWGAISQRGPIS-NSLLYV--QVKALSRESCQK---TYLRQLPETT 190

  Fly   207 LC-TGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISWIS 264
            :| ..|...|.  |..|||||......|:|:.|:....||:| :|..|.:||...:||:
  Fly   191 MCLLHPKDKGA--CYGDSGGPATYQGKLVGLASFVIGGCGRA-APDGYERVSKLRNWIA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 62/231 (27%)
Tryp_SPc 36..266 CDD:238113 63/233 (27%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 62/231 (27%)
Tryp_SPc 28..248 CDD:238113 63/233 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.