DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG33159

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:250 Identity:71/250 - (28%)
Similarity:117/250 - (46%) Gaps:16/250 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLLLLLGICRISGV-AIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHC 77
            ||.||..:|.::.| ...:.:.|:|||....::..||.|.::..|...|..|::::..:::||||
  Fly     3 GLRLLWWLCHLALVLPSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHC 67

  Fly    78 LTNSNQVLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWS---- 138
            :..| |..|.|:.||:..:|..|..  .|::..|..:..|:......|:.::......|.:    
  Fly    68 VYGS-QPEGFTVHAGASRLDQEAPV--VRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKV 129

  Fly   139 AAVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVH 203
            |.::|...|..|   ...|.:.|||.|...|..  |:.....|.|.::..:.|:.:....| .:.
  Fly   130 ATISPCRNPPEG---NAYARISGWGVTRENNRE--PAEQVRTTMVRVLPGAECKISYSGYG-QLS 188

  Fly   204 STNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSS 258
            .:.||.. :.|....|:.|||||||....:.|||||| ..|.:.:.|.||..|:|
  Fly   189 DSMLCAA-VRGLRDSCSGDSGGPLVYRGQVCGIVSWG-FGCARPSFPGVYTNVAS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 64/227 (28%)
Tryp_SPc 36..266 CDD:238113 63/226 (28%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 64/226 (28%)
Tryp_SPc 26..251 CDD:238113 63/226 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455643
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.