DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG32834

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:253 Identity:68/253 - (26%)
Similarity:106/253 - (41%) Gaps:36/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQVLGSTLV---AGSI 94
            :.|::||....:..|||...:...||..|:.:|:.::.::|||.|:    |..||..|   ..|.
  Fly    24 QSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIITAASCV----QSYGSIEVRVGTSSR 84

  Fly    95 AVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTL----PSSGVVPTG 155
            ..|||....:...|   :.:..|.......::.::........|.|:.|:::    |..|    .
  Fly    85 DYDGTGFLLEVCEI---INHPQYNCWRFDNNLALLKLCDPLKTSEAIQPISIAEDEPDDG----S 142

  Fly   156 TANLYGWGSTSTTNT------ASYPSTLQVATNVPIISLSSCESA----LGTKGSDVHSTNLCTG 210
            ...:.||||||...:      .|.|..||:|. |.:.:...|.:.    .|...:.:....|||.
  Fly   143 WCTVSGWGSTSWWGSWWDRCFGSLPDYLQMAW-VSVYNREQCAADRGVWFGLWDNGISYLTLCTH 206

  Fly   211 PLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISWISANQQ 268
            ...||   |:.|:|.|||....|:||:|.|    |....|.||..|..|..||:.|.:
  Fly   207 NGAGG---CSYDTGAPLVIDGQLVGILSEG----GCTTKPDVYANVPWFTGWIAENTE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 65/244 (27%)
Tryp_SPc 36..266 CDD:238113 66/246 (27%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 65/244 (27%)
Tryp_SPc 27..255 CDD:238113 66/246 (27%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.