DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and CG6041

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:278 Identity:84/278 - (30%)
Similarity:128/278 - (46%) Gaps:48/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLASGLLLLLGICRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQ--------YGGTHYCAASIL 66
            :||||..|       |....|..|.::|||..|::....|.||::        ||..|.|...::
  Fly    16 ALASGESL-------SSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVI 73

  Fly    67 NANWLVTAAHC--LTNSNQ---------VLGSTLVAGSIAVDGTASTTQTRSITYF----VINDL 116
            :...:.|||||  :|:..:         |:|||.:        |:||  .|::.|:    :.::.
  Fly    74 SQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYL--------TSST--DRTLMYYLQQLITHEN 128

  Fly   117 YTGGTVPYDIGMIYTPTAFVWSAAVAPVTLPSSGVVPTGTANLY-GWGSTSTTNTASYPSTLQVA 180
            |....:..||.:::......|:.........:|.:|.|.|..|. |||......|.| .:|||.|
  Fly   129 YNPDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFS-SNTLQAA 192

  Fly   181 TNVPIISLSSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCG 245
            | |||:|.::|..:.    :.:..:.:|.|.|:|||..|..|||||:....:|.||||:| ..|.
  Fly   193 T-VPIVSYTTCRISY----NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYG-AGCA 251

  Fly   246 QANSPSVYVQVSSFISWI 263
            ....|.||..||.:..||
  Fly   252 APGYPGVYTNVSYYYDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 74/251 (29%)
Tryp_SPc 36..266 CDD:238113 76/252 (30%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 74/251 (29%)
Tryp_SPc 35..272 CDD:238113 76/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455594
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.