DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Klk8

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:270 Identity:79/270 - (29%)
Similarity:112/270 - (41%) Gaps:52/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLLLL-----GICRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTA 74
            ||.||     |:.|..|       .:::.|.....:|.|:..::..|....|...::...|::||
  Rat    14 LLFLLMGAWAGLTRAQG-------SKILEGQECKPHSQPWQTALFQGERLVCGGVLVGDRWVLTA 71

  Fly    75 AHCLTNSNQV-LGSTLVAGSIAVDGTASTTQ-TRSITYFVINDLYTGGTVP----YDIGMIYTPT 133
            |||..:...| ||...:...   |......| .|||.:...|     .:.|    :||.:|....
  Rat    72 AHCKKDKYSVRLGDHSLQKR---DEPEQEIQVARSIQHPCFN-----SSNPEDHSHDIMLIRLQN 128

  Fly   134 AFVWSAAVAPVTLPSSGVVPTGTANL----------YGWGSTSTTNTASYPSTLQVATNVPIISL 188
            :......|.|:.|          |||          .||| |.|:...::|:||..| .|.|.|.
  Rat   129 SANLGDKVKPIEL----------ANLCPKVGQKCIISGWG-TVTSPQENFPNTLNCA-EVKIYSQ 181

  Fly   189 SSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVY 253
            :.||.|...|   :....:|.|. :.|...|..|||||||...||.||.|||..|||:...|.||
  Rat   182 NKCERAYPGK---ITEGMVCAGS-SNGADTCQGDSGGPLVCNGVLQGITSWGSDPCGKPEKPGVY 242

  Fly   254 VQVSSFISWI 263
            .::..:.:||
  Rat   243 TKICRYTNWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 70/243 (29%)
Tryp_SPc 36..266 CDD:238113 72/244 (30%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 70/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.