DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Klk14

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_038956840.1 Gene:Klk14 / 308562 RGDID:1308606 Length:310 Species:Rattus norvegicus


Alignment Length:267 Identity:83/267 - (31%)
Similarity:121/267 - (45%) Gaps:16/267 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QTKSLASGLLLLLGICRISGVAIGAPEG--RVVGGSPAAVNSAPYAVSMQYG-GTHY-CAASILN 67
            ||.:..|.:||||.|.:...|||...:|  :::||.....||.|:.|::|.| |..: |...:|:
  Rat    53 QTWTSGSRMLLLLTILQALAVAIVQSQGDDKILGGYTCVQNSQPWQVALQAGPGRRFLCGGVLLS 117

  Fly    68 ANWLVTAAHCLTNSNQVLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTP 132
            ..|::|||||   :..:|...|  |...:....:|.|...:...|.:..|.......|:.::...
  Rat   118 DQWVITAAHC---ARPLLHVAL--GKHNLRRWEATQQVLRVVRQVPHPQYRPQAHDNDLMLLKLQ 177

  Fly   133 TAFVWSAAVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESAL-G 196
            .......||..:.:..|...|.....:.|||:|::. ...||:.|| ..||.|:....|..|. |
  Rat   178 RKVRLGRAVRTIPVARSCASPGTPCRVSGWGTTASP-IVRYPTALQ-CVNVNIMPEQVCHRAYPG 240

  Fly   197 TKGSDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFIS 261
            |    :.|..:|.|...||...|..|||||||....|.|:||||...|.....|.||..:.::.|
  Rat   241 T----ITSGMVCAGVPEGGKDSCQGDSGGPLVCQGQLQGLVSWGMERCAMPGYPGVYTNLCNYHS 301

  Fly   262 WISANQQ 268
            ||....|
  Rat   302 WIQRTMQ 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 68/230 (30%)
Tryp_SPc 36..266 CDD:238113 70/232 (30%)
Klk14XP_038956840.1 Tryp_SPc 84..306 CDD:238113 70/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.