DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Klk13

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001163876.1 Gene:Klk13 / 292848 RGDID:1309337 Length:276 Species:Rattus norvegicus


Alignment Length:259 Identity:82/259 - (31%)
Similarity:120/259 - (46%) Gaps:22/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLLLLGICR-----ISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTA 74
            |.|..||.|     ::|.  ....|.:.||.....:|.|:..::...|...|...:::..|::||
  Rat    13 LALSGGISRDYPKILNGT--NGTSGFLPGGYTCLPHSQPWQAALLVRGRLLCGGVLVHPKWVLTA 75

  Fly    75 AHCLTNSNQVLGSTLVAGSIAV----DGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAF 135
            |||..:     |.|:..|..|:    :|..:....|||.:.......|.....:||.::...:..
  Rat    76 AHCRKD-----GYTVHLGKHALGRVENGEQAMEVVRSIPHPEYQVSPTHLNHDHDIMLLELKSPV 135

  Fly   136 VWSAAVAPVTLPSSGVVPTGT-ANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKG 199
            ..|..|..:.|.:...:|||| ..:.||| |:|:...:||.|||.| |:.:.|...|......| 
  Rat   136 QLSNHVRTLQLSADDCLPTGTCCRVSGWG-TTTSPQVNYPKTLQCA-NIELRSDEECRQVYPGK- 197

  Fly   200 SDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISWI 263
              :.:..||.|...||...|..||||||:....|.||:|||..||||.|.|.||.:||.::.||
  Rat   198 --ITANMLCAGTKEGGKDSCEGDSGGPLICNGKLYGIISWGDFPCGQPNRPGVYTRVSKYLRWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 73/232 (31%)
Tryp_SPc 36..266 CDD:238113 75/233 (32%)
Klk13NP_001163876.1 Tryp_SPc 39..262 CDD:238113 75/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.