DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and TMPRSS11E

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_054777.2 Gene:TMPRSS11E / 28983 HGNCID:24465 Length:423 Species:Homo sapiens


Alignment Length:238 Identity:70/238 - (29%)
Similarity:111/238 - (46%) Gaps:16/238 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQVLGSTLVAGSIAVDGT 99
            |:|||:.......|:..|:|:.|:|.|.|:::||.|||:||||.|........|...| :.:   
Human   191 RIVGGTEVEEGEWPWQASLQWDGSHRCGATLINATWLVSAAHCFTTYKNPARWTASFG-VTI--- 251

  Fly   100 ASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTLPSSG--VVPTGTANLYGW 162
            ..:...|.:...::::.|...:..|||.:....:...::.||..|.||.:.  ..|.....:.|:
Human   252 KPSKMKRGLRRIIVHEKYKHPSHDYDISLAELSSPVPYTNAVHRVCLPDASYEFQPGDVMFVTGF 316

  Fly   163 GSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPL 227
            |:..  |.....:.|:.| .|.:|..::|........: :....||.|.|.|....|..||||||
Human   317 GALK--NDGYSQNHLRQA-QVTLIDATTCNEPQAYNDA-ITPRMLCAGSLEGKTDACQGDSGGPL 377

  Fly   228 VQGNV-----LIGIVSWGKLPCGQANSPSVYVQVSSFISWISA 265
            |..:.     |.||||||. .|.:.|.|.||.:|::...||::
Human   378 VSSDARDIWYLAGIVSWGD-ECAKPNKPGVYTRVTALRDWITS 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 68/234 (29%)
Tryp_SPc 36..266 CDD:238113 69/237 (29%)
TMPRSS11ENP_054777.2 SEA 51..156 CDD:307516
Tryp_SPc 192..420 CDD:238113 69/237 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.