DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Klk1c2

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_036809.1 Gene:Klk1c2 / 24841 RGDID:3888 Length:259 Species:Rattus norvegicus


Alignment Length:285 Identity:83/285 - (29%)
Similarity:117/285 - (41%) Gaps:75/285 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLLLLGICRISGVAIGAPEG--RVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHC 77
            |.|:|.:.||.    .||.|  |:|||.....||.|:.|::.  ..:.|...:::.:|::|||||
  Rat     6 LSLVLSVGRID----AAPPGQSRIVGGYKCEKNSQPWQVAVI--NEYLCGGVLIDPSWVITAAHC 64

  Fly    78 LTNSNQVL-------------GSTLVAGS---------IAVDGTASTTQTRSITYFVINDL---- 116
            .:|:.|||             ...||..|         |..:.|.......|      |||    
  Rat    65 YSNNYQVLLGRNNLFKDEPFAQRRLVRQSFRHPDYIPLIVTNDTEQPVHDHS------NDLMLLH 123

  Fly   117 ------YTGGTVPYDIGMIYTPTAFVWSAAVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASYPS 175
                  .|||....|:                |...|..|    .|....|||||:       ||
  Rat   124 LSEPADITGGVKVIDL----------------PTKEPKVG----STCLASGWGSTN-------PS 161

  Fly   176 TLQVATNVPIIS--LSSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVS 238
            .:.|:.::..::  |.|.|..:.|...:|....||.|.:.||...|..||||||:...||.||.|
  Rat   162 EMVVSHDLQCVNIHLLSNEKCIETYKDNVTDVMLCAGEMEGGKDTCAGDSGGPLICDGVLQGITS 226

  Fly   239 WGKLPCGQANSPSVYVQVSSFISWI 263
            .|..||.:..:|::|.::..|.|||
  Rat   227 GGATPCAKPKTPAIYAKLIKFTSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 73/261 (28%)
Tryp_SPc 36..266 CDD:238113 74/262 (28%)
Klk1c2NP_036809.1 Tryp_SPc 24..251 CDD:214473 73/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.