DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Klk1

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_036725.1 Gene:Klk1 / 24523 RGDID:2969 Length:261 Species:Rattus norvegicus


Alignment Length:263 Identity:84/263 - (31%)
Similarity:128/263 - (48%) Gaps:27/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLLLLGICRISGVAIGAPEG--RVVGGSPAAVNSAPYAVSMQYGGTHY-CAASILNANWLVTAAH 76
            |:|.|.:.  .|....||.|  ||:||.....||.|:.|:: |..|.| |...:::.:|::||||
  Rat     4 LILFLDLS--LGQIDAAPPGQSRVIGGYKCEKNSQPWQVAL-YSFTKYLCGGVLIDPSWVITAAH 65

  Fly    77 CLTNSNQV-LGSTLVAGSIAVDGTASTTQTRSITY-------FVINDLYT---GGTVPYDIGMIY 130
            |.:|:.|| ||    ..::..|...:..:..|.::       |::.: :|   |.....|:.:::
  Rat    66 CSSNNYQVWLG----RNNLLEDEPFAQHRLVSQSFPHPDYKPFLMRN-HTRKPGDDHSNDLMLLH 125

  Fly   131 TPTAFVWSAAVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESAL 195
            .......:..|..:.||:.......|....|||||... ...:|..|| ..|:.::|...|..|.
  Rat   126 LSQPADITDGVKVIDLPTEEPKVGSTCLASGWGSTKPL-IWEFPDDLQ-CVNIHLLSNEKCIKAY 188

  Fly   196 GTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFI 260
            ..|.:|:   .||.|.|.||...||.||||||:...||.||.|||.:||.:.|.|::|.::..|.
  Rat   189 KEKVTDL---MLCAGELEGGKDTCTGDSGGPLLCDGVLQGITSWGSVPCAKTNMPAIYTKLIKFT 250

  Fly   261 SWI 263
            |||
  Rat   251 SWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 75/239 (31%)
Tryp_SPc 36..266 CDD:238113 76/240 (32%)
Klk1NP_036725.1 Tryp_SPc 24..253 CDD:214473 75/239 (31%)
Tryp_SPc 25..256 CDD:238113 76/240 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.