DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Klk7

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_036002.1 Gene:Klk7 / 23993 MGIID:1346336 Length:249 Species:Mus musculus


Alignment Length:257 Identity:81/257 - (31%)
Similarity:122/257 - (47%) Gaps:24/257 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLLLLLGICRISGVAI-GAPEG-RVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAH 76
            |:.||..|..:..:|: .|.:| |::.|......|.|:.|::..|...:|...:::..|::||||
Mouse     2 GVWLLSLITVLLSLALETAGQGERIIDGYKCKEGSHPWQVALLKGNQLHCGGVLVDKYWVLTAAH 66

  Fly    77 CLTNSNQV-LGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAA 140
            |.....|| |||..:       |..|..:.::...| .:..|:..|...||.::........|:.
Mouse    67 CKMGQYQVQLGSDKI-------GDQSAQKIKATKSF-RHPGYSTKTHVNDIMLVRLDEPVKMSSK 123

  Fly   141 VAPVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESA----LGTKGSD 201
            |..|.||.....|..:..:.||| |:|:...::||.| :.::|.:||...|:..    ||     
Mouse   124 VEAVQLPEHCEPPGTSCTVSGWG-TTTSPDVTFPSDL-MCSDVKLISSRECKKVYKDLLG----- 181

  Fly   202 VHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISWI 263
              .|.||.|......:.|..|||||||..:.|.|:||||..||||.|.|.||.||..:..|:
Mouse   182 --KTMLCAGIPDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYKRWV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 73/232 (31%)
Tryp_SPc 36..266 CDD:238113 73/233 (31%)
Klk7NP_036002.1 Tryp_SPc 25..241 CDD:214473 73/232 (31%)
Serine protease. /evidence=ECO:0000250 26..246 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.