DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and PRSS55

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_940866.2 Gene:PRSS55 / 203074 HGNCID:30824 Length:352 Species:Homo sapiens


Alignment Length:255 Identity:70/255 - (27%)
Similarity:109/255 - (42%) Gaps:40/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNS-------NQVLGSTLVAG 92
            |:.||..|.|...|:.||:|.....:|..||||..|::||||||.:.       :.|||:.    
Human    67 RITGGMEAEVGEFPWQVSIQARSEPFCGGSILNKWWILTAAHCLYSEELFPEELSVVLGTN---- 127

  Fly    93 SIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTLPSSGVVPTGTA 157
                |.|:.:.:.:.:...:::..:....:..||.::...:.........|:.||:.    .|.|
Human   128 ----DLTSPSMEIKEVASIILHKDFKRANMDNDIALLLLASPIKLDDLKVPICLPTQ----PGPA 184

  Fly   158 N-----LYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALG--TKGSDVHSTNLCTGPLTGG 215
            .     :.|||.|:..:..|..:.|..|..| |:....|.....  ||..      ||.|.....
Human   185 TWRECWVAGWGQTNAADKNSVKTDLMKAPMV-IMDWEECSKMFPKLTKNM------LCAGYKNES 242

  Fly   216 VSICTSDSGGPLV------QGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISWISANQQV 269
            ...|..|||||||      :....:||:|||| .||:.|:|.:|..:.::..||....|:
Human   243 YDACKGDSGGPLVCTPEPGEKWYQVGIISWGK-SCGEKNTPGIYTSLVNYNLWIEKVTQL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 67/247 (27%)
Tryp_SPc 36..266 CDD:238113 68/249 (27%)
PRSS55NP_940866.2 Tryp_SPc 67..295 CDD:214473 67/247 (27%)
Tryp_SPc 68..298 CDD:238113 68/249 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.