DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and St14

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_036010597.1 Gene:St14 / 19143 MGIID:1338881 Length:875 Species:Mus musculus


Alignment Length:255 Identity:81/255 - (31%)
Similarity:118/255 - (46%) Gaps:29/255 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EGRVVGGSPAAVNSAPYAVSMQ-YGGTHYCAASILNANWLVTAAHCLTNSNQVLGS-----TLVA 91
            :.|||||:.|.....|:.||:. .|..|.|.||:::.:|||:||||..:......|     |...
Mouse   632 QARVVGGTNADEGEWPWQVSLHALGQGHLCGASLISPDWLVSAAHCFQDDKNFKYSDYTMWTAFL 696

  Fly    92 GSI-----AVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTLP-SSG 150
            |.:     :..|.......|.||:...||.    |..|||.::....:..:|..|.|:.|| ::.
Mouse   697 GLLDQSKRSASGVQELKLKRIITHPSFNDF----TFDYDIALLELEKSVEYSTVVRPICLPDATH 757

  Fly   151 VVPTGTAN-LYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPLTG 214
            |.|.|.|. :.|||.|....|.:.  .||.. .:.:|:.::||..:   ...:....:|.|.|:|
Mouse   758 VFPAGKAIWVTGWGHTKEGGTGAL--ILQKG-EIRVINQTTCEDLM---PQQITPRMMCVGFLSG 816

  Fly   215 GVSICTSDSGGPL----VQGNVL-IGIVSWGKLPCGQANSPSVYVQVSSFISWISANQQV 269
            ||..|..||||||    ..|.:. .|:||||: .|.|.|.|.||.::.....||..:..|
Mouse   817 GVDSCQGDSGGPLSSAEKDGRMFQAGVVSWGE-GCAQRNKPGVYTRLPVVRDWIKEHTGV 875

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 78/245 (32%)
Tryp_SPc 36..266 CDD:238113 79/247 (32%)
St14XP_036010597.1 SEA 108..198 CDD:396113
CUB 247..352 CDD:238001
CUB 360..464 CDD:238001
LDLa 474..506 CDD:238060
LDLa 512..543 CDD:238060
LDLa 545..579 CDD:238060
LDLa 587..622 CDD:238060
Tryp_SPc 635..872 CDD:238113 79/247 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.