DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and svh-1

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:268 Identity:79/268 - (29%)
Similarity:119/268 - (44%) Gaps:40/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CRISGVAIGAPE------GRVVGGSPAAVNSAPYAVSMQYGGT--HYCAASILNANWLVTAAHCL 78
            |.:..|.:.|.:      .|||||......:.|:..:::...|  |:|.||||:...|:|||||.
 Worm   693 CGLRYVEVNARDAAKSRIARVVGGFETVPGAFPWTAALRNKATKAHHCGASILDKTHLITAAHCF 757

  Fly    79 TNSNQVLGSTLVAG---SIAVDGTASTTQTRSITYF-VINDLYTGGTVPYDIGMIYTP-TAFVWS 138
            ....:|....:|.|   :...||.......:.|.:: :..|:::     :||.::..| ....::
 Worm   758 EEDERVSSYEVVVGDWDNNQTDGNEQIFYLQRIHFYPLYKDIFS-----HDIAILEIPYPGIEFN 817

  Fly   139 AAVAPVTLPSSGVV--PTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSD 201
            ....|:.|||...|  |.....:.||||..    ..|...||.|. :|||:...|     ...|.
 Worm   818 EYAQPICLPSKDFVYTPGRQCVVSGWGSMG----LRYAERLQAAL-IPIINRFDC-----VNSSQ 872

  Fly   202 VHS----TNLCTGPLTGGVSICTSDSGGPLV-----QGNVLIGIVSWGKLPCGQANSPSVYVQVS 257
            ::|    :..|.|.|.||:..|..|||||..     ...||.|::|||. .|.|...|.:|..|:
 Worm   873 IYSSMSRSAFCAGYLEGGIDSCQGDSGGPFACRREDGAFVLAGVISWGD-GCAQKKQPGIYTMVA 936

  Fly   258 SFISWISA 265
            .::|||||
 Worm   937 PYLSWISA 944

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 72/245 (29%)
Tryp_SPc 36..266 CDD:238113 75/248 (30%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 75/248 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.