DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Klk1b4

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_035045.2 Gene:Klk1b4 / 18048 MGIID:97320 Length:256 Species:Mus musculus


Alignment Length:274 Identity:85/274 - (31%)
Similarity:116/274 - (42%) Gaps:54/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLLLLGICRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLT 79
            |:|.|.: .:.|:....|    |.......||.|:.|::.....:.|...:|:.||::|||||..
Mouse     4 LILFLAL-SLGGIDAAPP----VQSQVDCENSQPWHVAVYRFNKYQCGGVLLDRNWVLTAAHCYN 63

  Fly    80 NSNQV-LGST------------LVAGSIA-VDGTAS-----TTQTRSITYFVINDLYTGGTV--- 122
            :..|| ||..            ||:.:|. .|...|     |.|.        .|.|:...:   
Mouse    64 DKYQVWLGKNNFLEDEPSDQHRLVSKAIPHPDFNMSLLNEHTPQP--------EDDYSNDLMLLR 120

  Fly   123 ---PYDIGMIYTPTAFVWSAAVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVP 184
               |.||           :..|.|:|||:.......|....||||| |.....||..|| ..|:.
Mouse   121 LSKPADI-----------TDVVKPITLPTEEPKLGSTCLASGWGST-TPIKFKYPDDLQ-CVNLK 172

  Fly   185 IISLSSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANS 249
            ::....|:.|...|.:|   ..||.|.:.||...|..||||||:...:|.||.|||..|||:...
Mouse   173 LLPNEDCDKAHEMKVTD---AMLCAGEMDGGSYTCEHDSGGPLICDGILQGITSWGPEPCGEPTE 234

  Fly   250 PSVYVQVSSFISWI 263
            ||||.::..|.|||
Mouse   235 PSVYTKLIKFSSWI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 78/252 (31%)
Tryp_SPc 36..266 CDD:238113 80/253 (32%)
Klk1b4NP_035045.2 Tryp_SPc 13..251 CDD:238113 82/264 (31%)
Activation peptide homolog 18..24 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.