DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Klk1b22

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_034244.1 Gene:Klk1b22 / 13646 MGIID:95291 Length:259 Species:Mus musculus


Alignment Length:259 Identity:76/259 - (29%)
Similarity:122/259 - (47%) Gaps:22/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLLLGICRISGVAIGAP-EGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLT 79
            |:|.....:.|:....| :.|::||.....||.|:.|::.|...:.|...:|:.||::|||||..
Mouse     4 LILFLTLSLGGIDAAPPVQSRILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYE 68

  Fly    80 NSNQV-LGSTLVAGSIAVDGTASTTQTRSITY-------FVINDLYTGGTVPYDIGMIYTPTAFV 136
            :...: ||.    ..:..|..::..:..|.::       .::..:.||..:..|:.::.......
Mouse    69 DKYNIWLGK----NKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPAD 129

  Fly   137 WSAAVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASY--PSTLQVATNVPIISLSSCESALGTKG 199
            .:..|.|:.||::......|....||||   .|...|  |:.|| ..::.:.....|..|...|.
Mouse   130 ITDVVKPIDLPTTEPKLGSTCLASGWGS---INQLIYQNPNDLQ-CVSIKLHPNEVCVKAHILKV 190

  Fly   200 SDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISWI 263
            :||   .||.|.:.||...|..||||||:...||.||.|||..|||:.|:|::|.::..|.|||
Mouse   191 TDV---MLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 70/237 (30%)
Tryp_SPc 36..266 CDD:238113 71/238 (30%)
Klk1b22NP_034244.1 Tryp_SPc 24..251 CDD:214473 70/237 (30%)
Tryp_SPc 25..254 CDD:238113 71/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.