DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and Klk5

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_038952099.1 Gene:Klk5 / 102546758 RGDID:1593461 Length:293 Species:Rattus norvegicus


Alignment Length:273 Identity:71/273 - (26%)
Similarity:116/273 - (42%) Gaps:55/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NGQQTKSLASGLLLLLGICRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTH-YCAASILN 67
            :|:.|:|.:|                    .|:|.||....::.|:..::..|... ||.|.::|
  Rat    56 SGEDTRSDSS--------------------SRIVNGSDCPKDTQPWQGALLLGPNKLYCGAVLIN 100

  Fly    68 ANWLVTAAHCLTNSNQV-LGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTG-GTVPY------ 124
            ..||:|||||.....:: ||.                .:.|..|.....::.| .::|:      
  Rat   101 PQWLLTAAHCRKPVFRIRLGH----------------HSMSPVYESGQQMFQGIKSIPHPGYSHP 149

  Fly   125 ----DIGMIYTPTAFVWSAAVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPI 185
                |:.:|........|.:|.||.:.|..........:.|||:||:::. ::|..|| ..::.:
  Rat   150 GHSNDLMLIKMNRKIRASHSVKPVEITSDCPKEGTRCMVSGWGTTSSSHN-NFPKVLQ-CLDITV 212

  Fly   186 ISLSSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSP 250
            :|...|:::.   ...:..|..|.|...|..| |..|||||::....|.|:||||..||.|.|.|
  Rat   213 LSEERCKNSY---PGQIDKTMFCAGDEAGRDS-CQGDSGGPVICNGKLQGLVSWGDFPCAQPNRP 273

  Fly   251 SVYVQVSSFISWI 263
            .||..:..|:.||
  Rat   274 GVYTNLCEFVPWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 65/240 (27%)
Tryp_SPc 36..266 CDD:238113 66/241 (27%)
Klk5XP_038952099.1 Tryp_SPc 67..286 CDD:214473 65/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.