DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and LOC101733979

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_031749509.1 Gene:LOC101733979 / 101733979 -ID:- Length:895 Species:Xenopus tropicalis


Alignment Length:266 Identity:71/266 - (26%)
Similarity:106/266 - (39%) Gaps:48/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQVLGS 87
            |.||..|    ..:.|..|.:....|:.|.:...|...|..::::|||:||||||.|       .
 Frog   312 RSSGCGI----IEIQGSDPRSPGVWPWQVDLHKDGRRMCGGTLISANWVVTAAHCFT-------G 365

  Fly    88 TLVAGS------IAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIY--TPTAFVWSAAVAPV 144
            ||.:.|      :...||.:..:| .:....::..|.......||.::.  .|.:|      .|.
 Frog   366 TLSSDSPFDWSVVLAPGTPAVKET-PVQKITLHGAYVSTENGKDIALLQLTRPASF------GPY 423

  Fly   145 TLPSSGVVPTGTAN-LYGWGSTSTTNTASYPSTLQ---VATNVPIISLSSCE---SALGTKGSDV 202
            |||.  .:|..:.. |||.....|.....:|....   ...:|.:|..:.|.   |..||..:.|
 Frog   424 TLPV--CLPRASHRLLYGATCWHTGRDGPHPDGKMGPPKGASVELIGPNKCNCIYSKPGTTNASV 486

  Fly   203 H--STNLCTGPLTGGVSICTSDSGGPLVQGN----VLIGIVSWGKLPCGQANS---PSVYVQVSS 258
            .  .:.||.....|.   |.||||||||...    .|:|:.|:.. .|.:...   |.||.::|.
 Frog   487 SVLPSMLCAAQQEGQ---CLSDSGGPLVCNESGTWFLVGVQSFAG-SCQERRGKALPGVYTKLSD 547

  Fly   259 FISWIS 264
            :.:|||
 Frog   548 YENWIS 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 64/251 (25%)
Tryp_SPc 36..266 CDD:238113 67/253 (26%)
LOC101733979XP_031749509.1 Tryp_SPc 39..282 CDD:238113
Tryp_SPc 323..555 CDD:238113 67/251 (27%)
Tryp_SPc 598..824 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.