DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and LOC101732100

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_031749505.1 Gene:LOC101732100 / 101732100 -ID:- Length:327 Species:Xenopus tropicalis


Alignment Length:272 Identity:84/272 - (30%)
Similarity:130/272 - (47%) Gaps:27/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLASGLLLLLGICRI--------SGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASIL 66
            |:.:..|..||:..|        ..|||   ..|:|||..|.....|:...:...|.:.|..:::
 Frog     6 SICAFFLFALGLYTICEAEKACGKSVAI---SDRIVGGQDAKKGKYPWQALLWCPGVYRCGGTLV 67

  Fly    67 NANWLVTAAHCLTNSNQVLGSTL--VAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMI 129
            ::.|:|:|||||:.||   .|.|  :.|:..:.|..:.....|:....|:..|....:..|||:.
 Frog    68 SSKWVVSAAHCLSRSN---ASCLAVILGANKLSGNENEEMAVSVKNIYIHPNYNDTDITNDIGLA 129

  Fly   130 YTPTAFVWSAAVAPVTLPSSGVV--PTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCE 192
            ....|..:::.|.||.||::..:  |..:..:.|||.|. .||:..|:||| ...:.|:|...|.
 Frog   130 ELTQAVSFTSYVIPVCLPTASTIFNPGQSCWVTGWGVTE-FNTSLSPNTLQ-EVQMRILSAEQCR 192

  Fly   193 SALGTKGSDVHSTN--LCTGPLTGGVSICTSDSGGPLV---QGN-VLIGIVSWGKLPCGQANSPS 251
            |......:.|:.|:  :|...:.||...|..|||||||   .|| .|:|:||:| :.||....|.
 Frog   193 SYYDPNITGVYITDQMICARDILGGKDSCQGDSGGPLVCSYGGNFYLVGVVSFG-IGCGDTAYPG 256

  Fly   252 VYVQVSSFISWI 263
            ||..|.::..||
 Frog   257 VYTYVPAYRDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 74/237 (31%)
Tryp_SPc 36..266 CDD:238113 75/238 (32%)
LOC101732100XP_031749505.1 Tryp_SPc 37..268 CDD:238113 73/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.