DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and tmprss9

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_002940084.3 Gene:tmprss9 / 100489279 XenbaseID:XB-GENE-993973 Length:1151 Species:Xenopus tropicalis


Alignment Length:251 Identity:84/251 - (33%)
Similarity:118/251 - (47%) Gaps:21/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQVLGSTLVAGSIAVDGT 99
            |:||||.|.....|:.||::....|:|.|:::...|||:||||..:............:.::.||
 Frog   234 RIVGGSDATKGEFPWQVSLRENNEHFCGATVIGDKWLVSAAHCFNDFQDPAVWVAYIATTSLSGT 298

  Fly   100 ASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTLPS-SGVVPTG-TANLYGW 162
            .|:|...:|...:.:..|...|..||:.::...:...::....||.||. :.|.|.| ...:.||
 Frog   299 DSSTVKATIRNIIKHPSYDPDTADYDVAVLELDSPLKFNKYTQPVCLPDPTHVFPVGKKCIITGW 363

  Fly   163 GSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPL 227
            |.....|... |..||.|| |.|:..|.|.|..   .:.|....||.|.|.|.:..|..||||||
 Frog   364 GYLKEDNLVK-PEVLQKAT-VAIMDQSLCNSLY---SNVVTERMLCAGYLEGKIDSCQGDSGGPL 423

  Fly   228 V----QGN-VLIGIVSWGKLPCGQANSPSVYVQVSSFISWI--------SANQQVS 270
            |    .|. .|.|||||| :.|.:|..|.|||:||...:||        :|:.|.|
 Frog   424 VCEEPSGKFFLAGIVSWG-VGCAEARRPGVYVRVSKIRNWILDIISSSVAADPQTS 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 79/234 (34%)
Tryp_SPc 36..266 CDD:238113 80/244 (33%)
tmprss9XP_002940084.3 SEA 60..156 CDD:396113
LDLa 186..221 CDD:238060
Tryp_SPc 234..463 CDD:214473 79/234 (34%)
Tryp_SPc 547..774 CDD:238113
LDLa 871..906 CDD:238060
Tryp_SPc 919..1145 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.