DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae1 and tmprss11f

DIOPT Version :9

Sequence 1:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_004911133.1 Gene:tmprss11f / 100379970 XenbaseID:XB-GENE-1012399 Length:427 Species:Xenopus tropicalis


Alignment Length:253 Identity:89/253 - (35%)
Similarity:134/253 - (52%) Gaps:22/253 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQVLG 86
            |.|.|.::   ..|:|||:.|.:.|.|:..|::..|:|.|.||:||..|||.||||...:.....
 Frog   186 CGIGGPSV---SNRIVGGTNAGLGSWPWQASLRLLGSHTCGASLLNDTWLVAAAHCFDMNADANS 247

  Fly    87 STLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGM--IYTPTAFVWSAAVAPVTLP-S 148
            .|:|.|:|.|...:..    .|...:|.:.||......||.:  ::||..|  ::.:.||.|| :
 Frog   248 WTVVLGTINVYSGSEF----KIEKIIIYEGYTSHNHRNDIALLKLFTPLNF--TSIIRPVCLPEA 306

  Fly   149 SGVVPTGTA-NLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPL 212
            |.:.|.|:: .:.|||:.:...:||  ..||.| .|.||:..:|.|: ...|..::.:.:|.|..
 Frog   307 SDIFPDGSSCYITGWGALTDGGSAS--QVLQQA-EVKIINSDTCSSS-QMYGGLIYPSMICAGYA 367

  Fly   213 TGGVSICTSDSGGPLV---QGN-VLIGIVSWGKLPCGQANSPSVYVQVSSFISWISAN 266
            ||.:..|..|||||||   .|. |||||||:| ..|...|.|.||.:::...:||:|:
 Frog   368 TGQIDSCQGDSGGPLVTLKSGRWVLIGIVSFG-YGCALPNKPGVYSRITYLRNWITAH 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 83/235 (35%)
Tryp_SPc 36..266 CDD:238113 84/237 (35%)
tmprss11fXP_004911133.1 SEA 48..148 CDD:396113
Tryp_SPc 197..421 CDD:238113 82/234 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.