DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and YPT6

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_013363.1 Gene:YPT6 / 850966 SGDID:S000004252 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:217 Identity:131/217 - (60%)
Similarity:162/217 - (74%) Gaps:21/217 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQ 71
            |..|.|:|:||||||.|||||||||||||:||:.||||||||||||||||:|:|:||||||||||
Yeast     5 GKSLTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQ 69

  Fly    72 ERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSD-VIIMLVGNKTDLSDKRQV 135
            ||||||||||||||.||::|||||...||....|||:||:.|||.: ||:.:||||:||||:||:
Yeast    70 ERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGNKSDLSDERQI 134

  Fly   136 STEEGERKAKELNV-MFIETSAKAGYNVKQLFRRVAAALPGMDSTENKP--SEDMQEVVLKDSPN 197
            ||||||:|||.|.. :|:|||.|||||||.||:::|.:||...::|:.|  ||:      .:|.|
Yeast   135 STEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSLPEFQNSESTPLDSEN------ANSAN 193

  Fly   198 ETK-----------DPEGGCAC 208
            :.|           ..:..|.|
Yeast   194 QNKPGVIDISTAEEQEQSACQC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 117/161 (73%)
YPT6NP_013363.1 Rab6 11..173 CDD:206654 117/161 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 238 1.000 Domainoid score I380
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 253 1.000 Inparanoid score I654
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000767
OrthoInspector 1 1.000 - - oto100228
orthoMCL 1 0.900 - - OOG6_100976
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1276
SonicParanoid 1 1.000 - - X452
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.