DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and RAB6C

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_115520.2 Gene:RAB6C / 84084 HGNCID:16525 Length:254 Species:Homo sapiens


Alignment Length:207 Identity:165/207 - (79%)
Similarity:178/207 - (85%) Gaps:1/207 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLW 66
            :.||||||||||||||||||||.||||||||.||||||||||.||||||||||||||.|:.|:||
Human     3 AGGDFGNPLRKFKLVFLGEQSVAKTSLITRFRYDSFDNTYQAIIGIDFLSKTMYLEDGTIGLRLW 67

  Fly    67 DTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSD 131
            |||||||.|||||.|||||..|||||||||.|||.||:||||||||||||||||.||||:|||:|
Human    68 DTAGQERLRSLIPRYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIITLVGNRTDLAD 132

  Fly   132 KRQVSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKDSP 196
            |||||.||||||||.|||.||||.|||||||||||||||||||||:||::...|||.::.| :.|
Human   133 KRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLFRRVAAALPGMESTQDGSREDMSDIKL-EKP 196

  Fly   197 NETKDPEGGCAC 208
            .|....||||:|
Human   197 QEQTVSEGGCSC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 138/159 (87%)
RAB6CNP_115520.2 Required for centrosome localization 1..174 147/170 (86%)
Rab6 14..174 CDD:206654 138/159 (87%)
RAB 14..171 CDD:197555 135/156 (87%)
Effector region. /evidence=ECO:0000250 42..50 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 359 1.000 Inparanoid score I2215
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1277051at2759
OrthoFinder 1 1.000 - - FOG0000767
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X452
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.