DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and RAB34

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_024306736.1 Gene:RAB34 / 83871 HGNCID:16519 Length:408 Species:Homo sapiens


Alignment Length:109 Identity:39/109 - (35%)
Similarity:63/109 - (57%) Gaps:3/109 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 WDTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERG-SDVIIMLVGNKTDL 129
            |||||||||:.:..:|.|.:...::|:::.:..|...|.:|:.|...|.. |.|::.|||:|.||
Human   255 WDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQWLADALKENDPSSVLLFLVGSKKDL 319

  Fly   130 SDKRQVSTEEGE--RKAKELNVMFIETSAKAGYNVKQLFRRVAA 171
            |...|.:..|.:  :.|:|:...:...|:..|.||::.|.||||
Human   320 STPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAA 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 39/109 (36%)
RAB34XP_024306736.1 DNA_pol3_gamma3 <3..>171 CDD:331207
P-loop_NTPase <255..369 CDD:328724 39/109 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.