DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and RAB6A

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_181989.1 Gene:RAB6A / 819069 AraportID:AT2G44610 Length:208 Species:Arabidopsis thaliana


Alignment Length:202 Identity:150/202 - (74%)
Similarity:173/202 - (85%) Gaps:3/202 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERF 74
            |.|:||||||:|||||||:|||||||.||||||||||||||||||||||||||||||||||||||
plant     7 LAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERF 71

  Fly    75 RSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVSTEE 139
            |||||||||||:|||:|||:.:..||..|:||||:||||||||||::||||||||.||||||.||
plant    72 RSLIPSYIRDSSVAVIVYDVASRQSFLNTTKWIDEVRTERGSDVIVVLVGNKTDLVDKRQVSIEE 136

  Fly   140 GERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKDS---PNETKD 201
            .|.||:||||||||||||||:|:|.|||::|||||||::..:...|||.:|.||.|   .:..:.
plant   137 AEAKARELNVMFIETSAKAGFNIKALFRKIAAALPGMETLSSTKQEDMVDVNLKSSNANASLAQQ 201

  Fly   202 PEGGCAC 208
            ..|||:|
plant   202 QSGGCSC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 132/159 (83%)
RAB6ANP_181989.1 Rab6 10..170 CDD:206654 132/159 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 272 1.000 Domainoid score I434
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 305 1.000 Inparanoid score I757
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1277051at2759
OrthoFinder 1 1.000 - - FOG0000767
OrthoInspector 1 1.000 - - otm2567
orthoMCL 1 0.900 - - OOG6_100976
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X452
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.