DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and rab6a

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001315458.1 Gene:rab6a / 793785 ZFINID:ZDB-GENE-040426-2849 Length:208 Species:Danio rerio


Alignment Length:207 Identity:182/207 - (87%)
Similarity:193/207 - (93%) Gaps:1/207 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLW 66
            ::|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish     3 AAGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLW 67

  Fly    67 DTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSD 131
            ||||||||||||||||||||||||||||||.|||.||:|||||||||||||||||||||||||:|
Zfish    68 DTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLAD 132

  Fly   132 KRQVSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKDSP 196
            |||||.|||||||||||||||||||||||||||||||||||||||:||::|..|||.::.| :.|
Zfish   133 KRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDKSREDMIDIKL-EKP 196

  Fly   197 NETKDPEGGCAC 208
            .|....||||:|
Zfish   197 PEQPVSEGGCSC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 154/159 (97%)
rab6aNP_001315458.1 Rab6 14..174 CDD:206654 154/159 (97%)
RAB 14..171 CDD:197555 151/156 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595982
Domainoid 1 1.000 299 1.000 Domainoid score I1411
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 356 1.000 Inparanoid score I2202
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1277051at2759
OrthoFinder 1 1.000 - - FOG0000767
OrthoInspector 1 1.000 - - otm24328
orthoMCL 1 0.900 - - OOG6_100976
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1276
SonicParanoid 1 1.000 - - X452
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.